No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Brand: | Abnova |
| Reference: | H00000251-M07 |
| Product name: | ALPPL2 monoclonal antibody (M07), clone 2B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALPPL2. |
| Clone: | 2B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 251 |
| Gene name: | ALPPL2 |
| Gene alias: | ALPG|ALPPL|GCAP |
| Gene description: | alkaline phosphatase, placental-like 2 |
| Genbank accession: | NM_031313 |
| Immunogen: | ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE |
| Protein accession: | NP_112603 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to ALPPL2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Shipping condition: | Dry Ice |