| Brand: | Abnova |
| Reference: | H00000248-M03 |
| Product name: | ALPI monoclonal antibody (M03), clone 3A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALPI. |
| Clone: | 3A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 248 |
| Gene name: | ALPI |
| Gene alias: | IAP |
| Gene description: | alkaline phosphatase, intestinal |
| Genbank accession: | NM_001631 |
| Immunogen: | ALPI (NP_001622, 74 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV |
| Protein accession: | NP_001622 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ALPI monoclonal antibody (M03), clone 3A8 Western Blot analysis of ALPI expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Development of a fluorescence-based assay for drug interactions with human Multidrug Resistance Related Protein (MRP2; ABCC2) in MDCKII-MRP2 membrane vesicles.Lechner C, Reichel V, Moenning U, Reichel A, Fricker G. Eur J Pharm Biopharm. 2010 Mar 20. [Epub ahead of print] |