No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000246-M04 |
Product name: | ALOX15 monoclonal antibody (M04), clone 3D8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ALOX15. |
Clone: | 3D8 |
Isotype: | IgG2a Kappa |
Gene id: | 246 |
Gene name: | ALOX15 |
Gene alias: | 15-LOX-1 |
Gene description: | arachidonate 15-lipoxygenase |
Genbank accession: | BC029032 |
Immunogen: | ALOX15 (AAH29032, 1 a.a. ~ 662 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI |
Protein accession: | AAH29032 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (98.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | ALOX15 monoclonal antibody (M04), clone 3D8 Western Blot analysis of ALOX15 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Expression and localization ofprostaglandin receptors and stromal factors in human cervix?ariations in pregnant and non-pregnant states.Blesson CS, Roos N, Stephansson O, Masironi B, Reinert S, Stjernholm YV, Ekman-Ordeberg G, Sahlin L. Open Journal of Molecular and Integrative Physiology, 3, 147-157. |