No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00000242-M01 |
| Product name: | ALOX12B monoclonal antibody (M01), clone 3G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALOX12B. |
| Clone: | 3G12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 242 |
| Gene name: | ALOX12B |
| Gene alias: | 12R-LOX |
| Gene description: | arachidonate 12-lipoxygenase, 12R type |
| Genbank accession: | NM_001139 |
| Immunogen: | ALOX12B (NP_001130, 171 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAED |
| Protein accession: | NP_001130 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |