No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00000239-A01 |
| Product name: | ALOX12 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ALOX12. |
| Gene id: | 239 |
| Gene name: | ALOX12 |
| Gene alias: | 12-LOX|12S-LOX|LOG12 |
| Gene description: | arachidonate 12-lipoxygenase |
| Genbank accession: | NM_000697 |
| Immunogen: | ALOX12 (NP_000688, 564 a.a. ~ 663 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI |
| Protein accession: | NP_000688 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | ALOX12 polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of ALOX12 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Systematic analysis of rat 12/15-lipoxygenase enzymes reveals critical role for spinal eLOX3 hepoxilin synthase activity in inflammatory hyperalgesia.Gregus AM, Dumlao DS, Wei SC, Norris PC, Catella LC, Meyerstein FG, Buczynski MW, Steinauer JJ, Fitzsimmons BL, Yaksh TL, Dennis EA FASEB J. 2013 May;27(5):1939-49. doi: 10.1096/fj.12-217414. Epub 2013 Feb 4. |