| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00000231-D01P |
| Product name: | AKR1B1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human AKR1B1 protein. |
| Gene id: | 231 |
| Gene name: | AKR1B1 |
| Gene alias: | ADR|ALDR1|ALR2|AR|MGC1804 |
| Gene description: | aldo-keto reductase family 1, member B1 (aldose reductase) |
| Genbank accession: | NM_001628 |
| Immunogen: | AKR1B1 (NP_001619.1, 1 a.a. ~ 316 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF |
| Protein accession: | NP_001619.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of AKR1B1 expression in transfected 293T cell line (H00000231-T02) by AKR1B1 MaxPab polyclonal antibody. Lane 1: AKR1B1 transfected lysate(35.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |