Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALDH3B2 monoclonal antibody (M01), clone 3E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ALDH3B2 monoclonal antibody (M01), clone 3E6
| Brand: | Abnova |
| Reference: | H00000222-M01 |
| Product name: | ALDH3B2 monoclonal antibody (M01), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ALDH3B2. |
| Clone: | 3E6 |
| Isotype: | IgG1 kappa |
| Gene id: | 222 |
| Gene name: | ALDH3B2 |
| Gene alias: | ALDH8 |
| Gene description: | aldehyde dehydrogenase 3 family, member B2 |
| Genbank accession: | BC007685 |
| Immunogen: | ALDH3B2 (AAH07685, 1 a.a. ~ 385 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
| Protein accession: | AAH07685 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ALDH3B2 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W. FreshPatents.com |