| Brand: | Abnova |
| Reference: | H00000216-M01 |
| Product name: | ALDH1A1 monoclonal antibody (M01), clone 1A2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALDH1A1. |
| Clone: | 1A2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 216 |
| Gene name: | ALDH1A1 |
| Gene alias: | ALDC|ALDH-E1|ALDH1|ALDH11|MGC2318|PUMB1|RALDH1 |
| Gene description: | aldehyde dehydrogenase 1 family, member A1 |
| Genbank accession: | BC001505 |
| Immunogen: | ALDH1A1 (AAH01505, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMN |
| Protein accession: | AAH01505 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ALDH1A1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |