| Brand: | Abnova |
| Reference: | H00000215-M01 |
| Product name: | ABCD1 monoclonal antibody (M01), clone 4B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCD1. |
| Clone: | 4B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 215 |
| Gene name: | ABCD1 |
| Gene alias: | ABC42|ALD|ALDP|AMN |
| Gene description: | ATP-binding cassette, sub-family D (ALD), member 1 |
| Genbank accession: | BC015541 |
| Immunogen: | ABCD1 (AAH15541, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPVLSRPRPWRGNTLKRTAVLLALAAYGAHKVYPLVRQCLAPARGLQAPAGEPTQEASGVAAAKAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAA |
| Protein accession: | AAH15541 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |