Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALAS1 monoclonal antibody (M01), clone 3G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about ALAS1 monoclonal antibody (M01), clone 3G10
| Brand: | Abnova |
| Reference: | H00000211-M01 |
| Product name: | ALAS1 monoclonal antibody (M01), clone 3G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALAS1. |
| Clone: | 3G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 211 |
| Gene name: | ALAS1 |
| Gene alias: | ALAS|ALAS3|ALASH|MIG4 |
| Gene description: | aminolevulinate, delta-, synthase 1 |
| Genbank accession: | NM_000688 |
| Immunogen: | ALAS1 (NP_000679, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP |
| Protein accession: | NP_000679 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ALAS1 monoclonal antibody (M01), clone 3G10 Western Blot analysis of ALAS1 expression in JAR ( Cat # L003V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | PGC-1{alpha} is not mandatory for exercise- and training-induced adaptive gene responsens in mouse skeletal muscle.Leick L, Wojtaszewski JF, Johansen ST, Kiilerich K, Comes G, Hellsten Y, Hidalgo J, Pilegaard H. Am J Physiol Endocrinol Metab. 2008 Feb;294(2):E463-74. Epub 2007 Dec 11. |