| Brand: | Abnova |
| Reference: | H00000208-M05 |
| Product name: | AKT2 monoclonal antibody (M05), clone 1F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT2. |
| Clone: | 1F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 208 |
| Gene name: | AKT2 |
| Gene alias: | PKBB|PKBBETA|PRKBB|RAC-BETA |
| Gene description: | v-akt murine thymoma viral oncogene homolog 2 |
| Genbank accession: | M95936 |
| Immunogen: | AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII |
| Protein accession: | AAA58364 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |