Brand: | Abnova |
Reference: | H00000208-M03 |
Product name: | AKT2 monoclonal antibody (M03), clone 1D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT2. |
Clone: | 1D9 |
Isotype: | IgG1 Kappa |
Gene id: | 208 |
Gene name: | AKT2 |
Gene alias: | PKBB|PKBBETA|PRKBB|RAC-BETA |
Gene description: | v-akt murine thymoma viral oncogene homolog 2 |
Genbank accession: | M95936 |
Immunogen: | AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII |
Protein accession: | AAA58364 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Multiple defects in negative regulation of the PKB/Akt pathway sensitise human cancer cells to the antiproliferative effect of non-steroidal anti-inflammatory drugs.Lincova E, Hampl A, Pernicova Z, Starsichova A, Kramar P, Machala M, Kozubik A, Soucek K. Biochem Pharmacol. 2009 Sep 15;78(6):561-72. Epub 2009 May 9. |