| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000207-M26 |
| Product name: | AKT1 monoclonal antibody (M26), clone 3E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT1. |
| Clone: | 3E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 207 |
| Gene name: | AKT1 |
| Gene alias: | AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA |
| Gene description: | v-akt murine thymoma viral oncogene homolog 1 |
| Genbank accession: | BC000479 |
| Immunogen: | AKT1 (AAH00479, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA |
| Protein accession: | AAH00479 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of AKT1 expression in transfected 293T cell line by AKT1 monoclonal antibody (M26), clone 3E11. Lane 1: AKT1 transfected lysate(55.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |