No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00000207-M19 |
| Product name: | AKT1 monoclonal antibody (M19), clone 4E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT1. |
| Clone: | 4E2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 207 |
| Gene name: | AKT1 |
| Gene alias: | AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA |
| Gene description: | v-akt murine thymoma viral oncogene homolog 1 |
| Genbank accession: | BC000479 |
| Immunogen: | AKT1 (AAH00479.1, 127 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENR |
| Protein accession: | AAH00479.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to AKT1 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |