No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00000207-M01A |
Product name: | AKT1 monoclonal antibody (M01A), clone 4C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT1. |
Clone: | 4C3 |
Isotype: | IgG2a Kappa |
Gene id: | 207 |
Gene name: | AKT1 |
Gene alias: | AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA |
Gene description: | v-akt murine thymoma viral oncogene homolog 1 |
Genbank accession: | BC000479.2 |
Immunogen: | AKT1 (AAH00479.1, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA |
Protein accession: | AAH00479.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |