No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,IP,RNAi-Ab,PLA-Ce |
Brand: | Abnova |
Reference: | H00000207-M01 |
Product name: | AKT1 monoclonal antibody (M01), clone 4C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT1. |
Clone: | 4C3 |
Isotype: | IgG2a Kappa |
Gene id: | 207 |
Gene name: | AKT1 |
Gene alias: | AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA |
Gene description: | v-akt murine thymoma viral oncogene homolog 1 |
Genbank accession: | BC000479 |
Immunogen: | AKT1 (AAH00479, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA |
Protein accession: | AAH00479 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of AKT1 over-expressed 293 cell line, cotransfected with AKT1 Validated Chimera RNAi ( Cat # H00000207-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AKT1 monoclonal antibody (M01) clone 4C3 (Cat # H00000207-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | S-ELISA,ELISA,IP,RNAi-Ab,PLA-Ce |
Shipping condition: | Dry Ice |