Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AIF1 monoclonal antibody (M01), clone 2A2-B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about AIF1 monoclonal antibody (M01), clone 2A2-B6
| Brand: | Abnova |
| Reference: | H00000199-M01 |
| Product name: | AIF1 monoclonal antibody (M01), clone 2A2-B6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant AIF1. |
| Clone: | 2A2-B6 |
| Isotype: | IgG1 kappa |
| Gene id: | 199 |
| Gene name: | AIF1 |
| Gene alias: | AIF-1|IBA1|IRT-1 |
| Gene description: | allograft inflammatory factor 1 |
| Genbank accession: | BC009474 |
| Immunogen: | AIF1 (AAH09474.1, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP |
| Protein accession: | AAH09474.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.91 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AIF1 monoclonal antibody (M01), clone 2A2-B6 Western Blot analysis of AIF1 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Allograft inflammatory factor-1/Ionized calcium-binding adapter molecule 1 is specifically expressed by most subpopulations of macrophages and spermatids in testis.Kohler C. Cell Tissue Res. 2007 Nov;330(2):291-302. Epub 2007 Sep 13. |