No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00000197-M01 |
| Product name: | AHSG monoclonal antibody (M01), clone 5D8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant AHSG. |
| Clone: | 5D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 197 |
| Gene name: | AHSG |
| Gene alias: | A2HS|AHS|FETUA|HSGA |
| Gene description: | alpha-2-HS-glycoprotein |
| Genbank accession: | BC048198 |
| Immunogen: | AHSG (AAH48198.1, 19 a.a. ~ 367 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV |
| Protein accession: | AAH48198.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (64.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged AHSG is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A proteomics approach to identify changes in protein profiles in serum of Familial Adenomatous Polyposis patients.Quaresima B, Crugliano T, Gaspari M, Faniello MC, Cosimo P, Valanzano R, Genuardi M, Cannataro M, Veltri P, Baudi F, Doldo P, Cuda G, Venuta S, Costanzo F. Cancer Lett. 2008 Dec 8;272(1):40-52. Epub 2008 Jul 29. |