Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AHR monoclonal antibody (M02), clone 3B12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
More info about AHR monoclonal antibody (M02), clone 3B12
| Brand: | Abnova |
| Reference: | H00000196-M02 |
| Product name: | AHR monoclonal antibody (M02), clone 3B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AHR. |
| Clone: | 3B12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 196 |
| Gene name: | AHR |
| Gene alias: | bHLHe76 |
| Gene description: | aryl hydrocarbon receptor |
| Genbank accession: | NM_001621 |
| Immunogen: | AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN |
| Protein accession: | NP_001612 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to AHR on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Cross-talk between Aryl Hydrocarbon Receptor and the inflammatory response: a Role for NF-κB.Vogel CF, Khan EM, Leung PS, Gershwin ME, Chang WL, Wu D, Haarmann-Stemmann T, Hoffmann A, Denison MS J Biol Chem. 2014 Jan 17;289(3):1866-75. doi: 10.1074/jbc.M113.505578. Epub 2013 Dec 3. |