| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000190-M07 |
| Product name: | NR0B1 monoclonal antibody (M07), clone 3G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR0B1. |
| Clone: | 3G8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 190 |
| Gene name: | NR0B1 |
| Gene alias: | AHC|AHCH|AHX|DAX-1|DAX1|DSS|GTD|HHG|NROB1 |
| Gene description: | nuclear receptor subfamily 0, group B, member 1 |
| Genbank accession: | NM_000475 |
| Immunogen: | NR0B1 (NP_000466, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI |
| Protein accession: | NP_000466 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NR0B1 expression in transfected 293T cell line by NR0B1 monoclonal antibody (M07), clone 3G8. Lane 1: NR0B1 transfected lysate(51.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |