| Brand: | Abnova |
| Reference: | H00000190-M03A |
| Product name: | NR0B1 monoclonal antibody (M03A), clone 1F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR0B1. |
| Clone: | 1F10 |
| Isotype: | IgG3 Kappa |
| Gene id: | 190 |
| Gene name: | NR0B1 |
| Gene alias: | AHC|AHCH|AHX|DAX-1|DAX1|DSS|GTD|HHG|NROB1 |
| Gene description: | nuclear receptor subfamily 0, group B, member 1 |
| Genbank accession: | NM_000475 |
| Immunogen: | NR0B1 (NP_000466, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI |
| Protein accession: | NP_000466 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NR0B1 monoclonal antibody (M03A), clone 1F10 Western Blot analysis of NR0B1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |