| Brand: | Abnova |
| Reference: | H00000163-M01 |
| Product name: | AP2B1 monoclonal antibody (M01), clone 2D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AP2B1. |
| Clone: | 2D5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 163 |
| Gene name: | AP2B1 |
| Gene alias: | ADTB2|AP105B|AP2-BETA|CLAPB1|DKFZp781K0743 |
| Gene description: | adaptor-related protein complex 2, beta 1 subunit |
| Genbank accession: | NM_001282 |
| Immunogen: | AP2B1 (NP_001273.1, 585 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG |
| Protein accession: | NP_001273.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to AP2B1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |