| Brand: | Abnova |
| Reference: | H00000143-A01 |
| Product name: | PARP4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PARP4. |
| Gene id: | 143 |
| Gene name: | PARP4 |
| Gene alias: | ADPRTL1|PARPL|PH5P|VAULT3|VPARP|VWA5C|p193 |
| Gene description: | poly (ADP-ribose) polymerase family, member 4 |
| Genbank accession: | NM_006437 |
| Immunogen: | PARP4 (NP_006428, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KENGGKFSFSLNPQCTHIILDNADVLSQYQLNSIQKNHVHIANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCPDSATEEEDTVELTEFGMQNV |
| Protein accession: | NP_006428 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |