Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PARP1 monoclonal antibody (M01), clone 3G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about PARP1 monoclonal antibody (M01), clone 3G4
| Brand: | Abnova |
| Reference: | H00000142-M01 |
| Product name: | PARP1 monoclonal antibody (M01), clone 3G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PARP1. |
| Clone: | 3G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 142 |
| Gene name: | PARP1 |
| Gene alias: | ADPRT|ADPRT1|PARP|PARP-1|PPOL|pADPRT-1 |
| Gene description: | poly (ADP-ribose) polymerase 1 |
| Genbank accession: | BC037545 |
| Immunogen: | PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD |
| Protein accession: | AAH37545 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to PARP1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The Metastasis Efficiency Modifier Ribosomal RNA Processing 1 Homolog B (RRP1B) Is a Chromatin-associated Factor.Crawford NP, Yang H, Mattaini KR, Hunter KW. J Biol Chem. 2009 Oct 16;284(42):28660-73. Epub 2009 Aug 26. |