Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 679,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 679,00 €
Data sheet of ADORA3 monoclonal antibody (M01), clone 1A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ADORA3 monoclonal antibody (M01), clone 1A3
| Brand: | Abnova |
| Reference: | H00000140-M01 |
| Product name: | ADORA3 monoclonal antibody (M01), clone 1A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ADORA3. |
| Clone: | 1A3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 140 |
| Gene name: | ADORA3 |
| Gene alias: | A3AR|AD026|bA552M11.5 |
| Gene description: | adenosine A3 receptor |
| Genbank accession: | BC029831 |
| Immunogen: | ADORA3 (AAH29831, 121 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE |
| Protein accession: | AAH29831 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ADORA3 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Adenosine receptor expression in rheumatoid synovium: a basis for methotrexate action.Stamp LK, Hazlett J, Roberts RL, Frampton C, Highton J, Hessian PA. Arthritis Res Ther. 2012 Jun 8;14(3):R138. |