ACY1 monoclonal antibody (M02), clone 1A11-F6 View larger

ACY1 monoclonal antibody (M02), clone 1A11-F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACY1 monoclonal antibody (M02), clone 1A11-F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about ACY1 monoclonal antibody (M02), clone 1A11-F6

Brand: Abnova
Reference: H00000095-M02
Product name: ACY1 monoclonal antibody (M02), clone 1A11-F6
Product description: Mouse monoclonal antibody raised against a full-length recombinant ACY1.
Clone: 1A11-F6
Isotype: IgG1 Kappa
Gene id: 95
Gene name: ACY1
Gene alias: ACY1D|ACYLASE
Gene description: aminoacylase 1
Genbank accession: BC000545
Immunogen: ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Protein accession: AAH00545
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000095-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (70.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000095-M02-31-15-1.jpg
Application image note: Immunoprecipitation of ACY1 transfected lysate using anti-ACY1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ACY1 MaxPab rabbit polyclonal antibody.
Applications: ELISA,WB-Re,WB-Tr,IP
Related products: - ACYP1 monoclonal antibody (M01), clone 1B2-3A2
- ACYP2 monoclonal antibody (M06), clone 2H7
- ADA monoclonal antibody (M01), clone 4G4-1C6
- ADCY2 monoclonal antibody (M01), clone 1D4
- ADCY5 monoclonal antibody (M01), clone 3E6
Shipping condition: Dry Ice

Buy ACY1 monoclonal antibody (M02), clone 1A11-F6 now

Add to cart