ACY1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

ACY1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACY1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about ACY1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000095-D01P
Product name: ACY1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ACY1 protein.
Gene id: 95
Gene name: ACY1
Gene alias: ACY1D|ACYLASE
Gene description: aminoacylase 1
Genbank accession: NM_000666.1
Immunogen: ACY1 (NP_000657.1, 1 a.a. ~ 408 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Protein accession: NP_000657.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00000095-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ACY1 expression in transfected 293T cell line (H00000095-T01) by ACY1 MaxPab polyclonal antibody.

Lane 1: ACY1 transfected lysate(45.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Related products: - ACYP2 polyclonal antibody (A01)
- ADA polyclonal antibody (A01)
- ADA purified MaxPab mouse polyclonal antibody (B01P)
- ADA MaxPab rabbit polyclonal antibody (D01)
- ADA purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy ACY1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart