ACY1 polyclonal antibody (A01) View larger

ACY1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACY1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACY1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00000095-A01
Product name: ACY1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant ACY1.
Gene id: 95
Gene name: ACY1
Gene alias: ACY1D|ACYLASE
Gene description: aminoacylase 1
Genbank accession: BC000545
Immunogen: ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Protein accession: AAH00545
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000095-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (70.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - ACY1 purified MaxPab mouse polyclonal antibody (B01P)
- ACY1 purified MaxPab rabbit polyclonal antibody (D01P)
- ACYP2 polyclonal antibody (A01)
- ADA polyclonal antibody (A01)
- ADA purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice
Publications: Acylase 1 expression in rat intestinal crypt-villus axis.Cigna N, Nicoletti C, Durand A, Chaix JC, Giardina T, Perrier J.
Cell Biol Int. 2007 Sep;31(9):966-73. Epub 2007 Mar 18.

Buy ACY1 polyclonal antibody (A01) now

Add to cart