Login to display prices
Login to display prices
ACY1 polyclonal antibody (A01) View larger

ACY1 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACY1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACY1 polyclonal antibody (A01)

Reference: H00000095-A01
Product name: ACY1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant ACY1.
Gene id: 95
Gene name: ACY1
Gene alias: ACY1D|ACYLASE
Gene description: aminoacylase 1
Genbank accession: BC000545
Immunogen: ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Protein accession: AAH00545
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: