ACVRL1 monoclonal antibody (M09), clone 1E7 View larger

ACVRL1 monoclonal antibody (M09), clone 1E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVRL1 monoclonal antibody (M09), clone 1E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ACVRL1 monoclonal antibody (M09), clone 1E7

Brand: Abnova
Reference: H00000094-M09
Product name: ACVRL1 monoclonal antibody (M09), clone 1E7
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
Clone: 1E7
Isotype: IgG2a Kappa
Gene id: 94
Gene name: ACVRL1
Gene alias: ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene description: activin A receptor type II-like 1
Genbank accession: BC042637
Immunogen: ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Protein accession: AAH42637
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000094-M09-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ACVRL1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Related products: - ACY1 monoclonal antibody (M01), clone 4F1-B7
- ACY1 monoclonal antibody (M02), clone 1A11-F6
- ACYP1 monoclonal antibody (M01), clone 1B2-3A2
- ACYP2 monoclonal antibody (M06), clone 2H7
- ADA monoclonal antibody (M01), clone 4G4-1C6
Shipping condition: Dry Ice

Buy ACVRL1 monoclonal antibody (M09), clone 1E7 now

Add to cart