Login to display prices
Login to display prices
ACVRL1 monoclonal antibody (M09), clone 1E7 View larger

ACVRL1 monoclonal antibody (M09), clone 1E7

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVRL1 monoclonal antibody (M09), clone 1E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ACVRL1 monoclonal antibody (M09), clone 1E7

Reference: H00000094-M09
Product name: ACVRL1 monoclonal antibody (M09), clone 1E7
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
Clone: 1E7
Isotype: IgG2a Kappa
Gene id: 94
Gene name: ACVRL1
Gene alias: ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene description: activin A receptor type II-like 1
Genbank accession: BC042637
Immunogen: ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Protein accession: AAH42637
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: