ACVRL1 monoclonal antibody (M05), clone 5F2 View larger

ACVRL1 monoclonal antibody (M05), clone 5F2

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVRL1 monoclonal antibody (M05), clone 5F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACVRL1 monoclonal antibody (M05), clone 5F2

Brand: Abnova
Reference: H00000094-M05
Product name: ACVRL1 monoclonal antibody (M05), clone 5F2
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
Clone: 5F2
Isotype: IgG1 Kappa
Gene id: 94
Gene name: ACVRL1
Gene alias: ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene description: activin A receptor type II-like 1
Genbank accession: BC042637
Immunogen: ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Protein accession: AAH42637
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000094-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - ACVRL1 monoclonal antibody (M06), clone 2C12
- ACVRL1 monoclonal antibody (M09), clone 1E7
- ACY1 monoclonal antibody (M01), clone 4F1-B7
- ACY1 monoclonal antibody (M02), clone 1A11-F6
- ACYP1 monoclonal antibody (M01), clone 1B2-3A2
Shipping condition: Dry Ice

Buy ACVRL1 monoclonal antibody (M05), clone 5F2 now

Add to cart