Login to display prices
Login to display prices
ACVRL1 monoclonal antibody (M01), clone 5B1 View larger

ACVRL1 monoclonal antibody (M01), clone 5B1

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVRL1 monoclonal antibody (M01), clone 5B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ACVRL1 monoclonal antibody (M01), clone 5B1

Reference: H00000094-M01
Product name: ACVRL1 monoclonal antibody (M01), clone 5B1
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
Clone: 5B1
Isotype: IgG1 Kappa
Gene id: 94
Gene name: ACVRL1
Gene alias: ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene description: activin A receptor type II-like 1
Genbank accession: BC042637
Immunogen: ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Protein accession: AAH42637
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: