Login to display prices
Login to display prices
ACVRL1 polyclonal antibody (A01) View larger

ACVRL1 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVRL1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACVRL1 polyclonal antibody (A01)

Reference: H00000094-A01
Product name: ACVRL1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVRL1.
Gene id: 94
Gene name: ACVRL1
Gene alias: ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene description: activin A receptor type II-like 1
Genbank accession: BC042637
Immunogen: ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Protein accession: AAH42637
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: