ACVRL1 polyclonal antibody (A01) View larger

ACVRL1 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVRL1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACVRL1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00000094-A01
Product name: ACVRL1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVRL1.
Gene id: 94
Gene name: ACVRL1
Gene alias: ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene description: activin A receptor type II-like 1
Genbank accession: BC042637
Immunogen: ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Protein accession: AAH42637
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000094-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - ACY1 polyclonal antibody (A01)
- ACY1 purified MaxPab mouse polyclonal antibody (B01P)
- ACY1 purified MaxPab rabbit polyclonal antibody (D01P)
- ACYP2 polyclonal antibody (A01)
- ADA polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy ACVRL1 polyclonal antibody (A01) now

Add to cart