Login to display prices
Login to display prices
ACVR2B monoclonal antibody (M03), clone 1C11 View larger

ACVR2B monoclonal antibody (M03), clone 1C11

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR2B monoclonal antibody (M03), clone 1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ACVR2B monoclonal antibody (M03), clone 1C11

Reference: H00000093-M03
Product name: ACVR2B monoclonal antibody (M03), clone 1C11
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVR2B.
Clone: 1C11
Isotype: IgG2a Kappa
Gene id: 93
Gene name: ACVR2B
Gene alias: ACTRIIB|ActR-IIB|MGC116908
Gene description: activin A receptor, type IIB
Genbank accession: NM_001106
Immunogen: ACVR2B (NP_001097, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Protein accession: NP_001097
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: