ACVR2B polyclonal antibody (A01) View larger

ACVR2B polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR2B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ACVR2B polyclonal antibody (A01)

Brand: Abnova
Reference: H00000093-A01
Product name: ACVR2B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVR2B.
Gene id: 93
Gene name: ACVR2B
Gene alias: ACTRIIB|ActR-IIB|MGC116908
Gene description: activin A receptor, type IIB
Genbank accession: NM_001106
Immunogen: ACVR2B (NP_001097, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Protein accession: NP_001097
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000093-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000093-A01-1-15-1.jpg
Application image note: ACVR2B polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of ACVR2B expression in 293 ( Cat # L026V1 ).
Applications: WB-Ce,ELISA,WB-Re
Related products: - ACVR2B MaxPab mouse polyclonal antibody (B01)
- ACVR2B purified MaxPab mouse polyclonal antibody (B01P)
- ACVR2B MaxPab rabbit polyclonal antibody (D01)
- ACVRL1 polyclonal antibody (A01)
- ACY1 polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy ACVR2B polyclonal antibody (A01) now

Add to cart