Login to display prices
Login to display prices
ACVR2B polyclonal antibody (A01) View larger

ACVR2B polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR2B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ACVR2B polyclonal antibody (A01)

Reference: H00000093-A01
Product name: ACVR2B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVR2B.
Gene id: 93
Gene name: ACVR2B
Gene alias: ACTRIIB|ActR-IIB|MGC116908
Gene description: activin A receptor, type IIB
Genbank accession: NM_001106
Immunogen: ACVR2B (NP_001097, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Protein accession: NP_001097
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: