ACVR2A polyclonal antibody (A01) View larger

ACVR2A polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR2A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACVR2A polyclonal antibody (A01)

Brand: Abnova
Reference: H00000092-A01
Product name: ACVR2A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVR2A.
Gene id: 92
Gene name: ACVR2A
Gene alias: ACTRII|ACVR2
Gene description: activin A receptor, type IIA
Genbank accession: NM_001616
Immunogen: ACVR2A (AAH67418.1, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPK
Protein accession: AAH67418.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000092-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - ACVR2A purified MaxPab mouse polyclonal antibody (B02P)
- ACVR2B polyclonal antibody (A01)
- ACVR2B MaxPab mouse polyclonal antibody (B01)
- ACVR2B purified MaxPab mouse polyclonal antibody (B01P)
- ACVR2B MaxPab rabbit polyclonal antibody (D01)
Shipping condition: Dry Ice

Buy ACVR2A polyclonal antibody (A01) now

Add to cart