Login to display prices
Login to display prices
ACVR2A polyclonal antibody (A01) View larger

ACVR2A polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR2A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACVR2A polyclonal antibody (A01)

Reference: H00000092-A01
Product name: ACVR2A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVR2A.
Gene id: 92
Gene name: ACVR2A
Gene alias: ACTRII|ACVR2
Gene description: activin A receptor, type IIA
Genbank accession: NM_001616
Immunogen: ACVR2A (AAH67418.1, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPK
Protein accession: AAH67418.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: