Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000092-A01 |
Product name: | ACVR2A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ACVR2A. |
Gene id: | 92 |
Gene name: | ACVR2A |
Gene alias: | ACTRII|ACVR2 |
Gene description: | activin A receptor, type IIA |
Genbank accession: | NM_001616 |
Immunogen: | ACVR2A (AAH67418.1, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPK |
Protein accession: | AAH67418.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Related products: | - ACVR2A purified MaxPab mouse polyclonal antibody (B02P) - ACVR2B polyclonal antibody (A01) - ACVR2B MaxPab mouse polyclonal antibody (B01) - ACVR2B purified MaxPab mouse polyclonal antibody (B01P) - ACVR2B MaxPab rabbit polyclonal antibody (D01) |
Shipping condition: | Dry Ice |