Cart 9 Product Products 3 040,28 € (empty)
No products
To be determined Shipping
3 040,28 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 040,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 040,28 €
Data sheet of ACVR1B (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about ACVR1B (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00000091-Q01 |
| Product name: | ACVR1B (Human) Recombinant Protein (Q01) |
| Product description: | Human ACVR1B partial ORF ( AAH00254, 24 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 91 |
| Gene name: | ACVR1B |
| Gene alias: | ACTRIB|ACVRLK4|ALK4|SKR2 |
| Gene description: | activin A receptor, type IB |
| Genbank accession: | BC000254 |
| Immunogen sequence/protein sequence: | SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE |
| Protein accession: | AAH00254 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |