Login to display prices
Login to display prices
ACVR1B monoclonal antibody (M01), clone 2D4 View larger

ACVR1B monoclonal antibody (M01), clone 2D4

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR1B monoclonal antibody (M01), clone 2D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ACVR1B monoclonal antibody (M01), clone 2D4

Reference: H00000091-M01
Product name: ACVR1B monoclonal antibody (M01), clone 2D4
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVR1B.
Clone: 2D4
Isotype: IgG2a Kappa
Gene id: 91
Gene name: ACVR1B
Gene alias: ACTRIB|ACVRLK4|ALK4|SKR2
Gene description: activin A receptor, type IB
Genbank accession: BC000254
Immunogen: ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Protein accession: AAH00254
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: