Login to display prices
Login to display prices
ACVR1B polyclonal antibody (A01) View larger

ACVR1B polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR1B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACVR1B polyclonal antibody (A01)

Brand: Abnova
Reference: H00000091-A01
Product name: ACVR1B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVR1B.
Gene id: 91
Gene name: ACVR1B
Gene alias: ACTRIB|ACVRLK4|ALK4|SKR2
Gene description: activin A receptor, type IB
Genbank accession: BC000254
Immunogen: ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Protein accession: AAH00254
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000091-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - ACVR1B MaxPab rabbit polyclonal antibody (D01)
- ACVR2A polyclonal antibody (A01)
- ACVR2A purified MaxPab mouse polyclonal antibody (B02P)
- ACVR2B polyclonal antibody (A01)
- ACVR2B MaxPab mouse polyclonal antibody (B01)
Shipping condition: Dry Ice