ACVR1 monoclonal antibody (M07), clone 2D5 View larger

ACVR1 monoclonal antibody (M07), clone 2D5

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR1 monoclonal antibody (M07), clone 2D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ACVR1 monoclonal antibody (M07), clone 2D5

Brand: Abnova
Reference: H00000090-M07
Product name: ACVR1 monoclonal antibody (M07), clone 2D5
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVR1.
Clone: 2D5
Isotype: IgG1 Kappa
Gene id: 90
Gene name: ACVR1
Gene alias: ACTRI|ACVR1A|ACVRLK2|ALK2|FOP|SKR1|TSRI
Gene description: activin A receptor, type I
Genbank accession: BC033867
Immunogen: ACVR1 (AAH33867, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
Protein accession: AAH33867
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000090-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000090-M07-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ACVR1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Related products: - ACVR1B monoclonal antibody (M01), clone 2D4
- ACVR1B monoclonal antibody (M02), clone 6D3
- ACVR1B monoclonal antibody (M06), clone 2E12
- ACVR1B monoclonal antibody (M08), clone 6G11
- ACVR1B monoclonal antibody (M09), clone 1C1
Shipping condition: Dry Ice

Buy ACVR1 monoclonal antibody (M07), clone 2D5 now

Add to cart