Login to display prices
Login to display prices
ACVR1 monoclonal antibody (M07), clone 2D5 View larger

ACVR1 monoclonal antibody (M07), clone 2D5

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR1 monoclonal antibody (M07), clone 2D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ACVR1 monoclonal antibody (M07), clone 2D5

Reference: H00000090-M07
Product name: ACVR1 monoclonal antibody (M07), clone 2D5
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVR1.
Clone: 2D5
Isotype: IgG1 Kappa
Gene id: 90
Gene name: ACVR1
Gene alias: ACTRI|ACVR1A|ACVRLK2|ALK2|FOP|SKR1|TSRI
Gene description: activin A receptor, type I
Genbank accession: BC033867
Immunogen: ACVR1 (AAH33867, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
Protein accession: AAH33867
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: