Login to display prices
Login to display prices
ACVR1 polyclonal antibody (A01) View larger

ACVR1 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACVR1 polyclonal antibody (A01)

Reference: H00000090-A01
Product name: ACVR1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVR1.
Gene id: 90
Gene name: ACVR1
Gene alias: ACTRI|ACVR1A|ACVRLK2|ALK2|FOP|SKR1|TSRI
Gene description: activin A receptor, type I
Genbank accession: BC033867
Immunogen: ACVR1 (AAH33867, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
Protein accession: AAH33867
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: