ACVR1 polyclonal antibody (A01) View larger

ACVR1 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACVR1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00000090-A01
Product name: ACVR1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACVR1.
Gene id: 90
Gene name: ACVR1
Gene alias: ACTRI|ACVR1A|ACVRLK2|ALK2|FOP|SKR1|TSRI
Gene description: activin A receptor, type I
Genbank accession: BC033867
Immunogen: ACVR1 (AAH33867, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
Protein accession: AAH33867
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000090-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - ACVR1B polyclonal antibody (A01)
- ACVR1B MaxPab rabbit polyclonal antibody (D01)
- ACVR2A polyclonal antibody (A01)
- ACVR2A purified MaxPab mouse polyclonal antibody (B02P)
- ACVR2B polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy ACVR1 polyclonal antibody (A01) now

Add to cart