Cart 11 Product Products 3 247,34 € (empty)
No products
To be determined Shipping
3 247,34 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 11 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 247,34 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 247,34 €
Data sheet of ACTN1 monoclonal antibody (M01A), clone 3F1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about ACTN1 monoclonal antibody (M01A), clone 3F1
| Brand: | Abnova |
| Reference: | H00000087-M01A |
| Product name: | ACTN1 monoclonal antibody (M01A), clone 3F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACTN1. |
| Clone: | 3F1 |
| Isotype: | IgG3 Kappa |
| Gene id: | 87 |
| Gene name: | ACTN1 |
| Gene alias: | FLJ40884 |
| Gene description: | actinin, alpha 1 |
| Genbank accession: | NM_001102 |
| Immunogen: | ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA |
| Protein accession: | NP_001093 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ACTN1 expression in transfected 293T cell line by ACTN1 monoclonal antibody (M01A), clone 3F1. Lane 1: ACTN1 transfected lysate(103.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |