Login to display prices
Login to display prices
ACTN1 monoclonal antibody (M01A), clone 3F1 View larger

ACTN1 monoclonal antibody (M01A), clone 3F1

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACTN1 monoclonal antibody (M01A), clone 3F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ACTN1 monoclonal antibody (M01A), clone 3F1

Reference: H00000087-M01A
Product name: ACTN1 monoclonal antibody (M01A), clone 3F1
Product description: Mouse monoclonal antibody raised against a partial recombinant ACTN1.
Clone: 3F1
Isotype: IgG3 Kappa
Gene id: 87
Gene name: ACTN1
Gene alias: FLJ40884
Gene description: actinin, alpha 1
Genbank accession: NM_001102
Immunogen: ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA
Protein accession: NP_001093
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: