ACTN1 polyclonal antibody (A01) View larger

ACTN1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACTN1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ACTN1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00000087-A01
Product name: ACTN1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACTN1.
Gene id: 87
Gene name: ACTN1
Gene alias: FLJ40884
Gene description: actinin, alpha 1
Genbank accession: NM_001102
Immunogen: ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA
Protein accession: NP_001093
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000087-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000087-A01-1-22-1.jpg
Application image note: ACTN1 polyclonal antibody (A01), Lot # 051128JC01 Western Blot analysis of ACTN1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Related products: - ACTN1 purified MaxPab rabbit polyclonal antibody (D01P)
- ACTN2 MaxPab mouse polyclonal antibody (B01)
- ACVR1 polyclonal antibody (A01)
- ACVR1B polyclonal antibody (A01)
- ACVR1B MaxPab rabbit polyclonal antibody (D01)
Shipping condition: Dry Ice

Buy ACTN1 polyclonal antibody (A01) now

Add to cart