Login to display prices
Login to display prices
ACTN1 polyclonal antibody (A01) View larger

ACTN1 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACTN1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ACTN1 polyclonal antibody (A01)

Reference: H00000087-A01
Product name: ACTN1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACTN1.
Gene id: 87
Gene name: ACTN1
Gene alias: FLJ40884
Gene description: actinin, alpha 1
Genbank accession: NM_001102
Immunogen: ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA
Protein accession: NP_001093
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: