Cart 60 Product Products 8 895,38 € (empty)
No products
To be determined Shipping
8 895,38 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 60 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 895,38 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 8 895,38 €
Data sheet of ACTN1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ACTN1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000087-A01 |
| Product name: | ACTN1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ACTN1. |
| Gene id: | 87 |
| Gene name: | ACTN1 |
| Gene alias: | FLJ40884 |
| Gene description: | actinin, alpha 1 |
| Genbank accession: | NM_001102 |
| Immunogen: | ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA |
| Protein accession: | NP_001093 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ACTN1 polyclonal antibody (A01), Lot # 051128JC01 Western Blot analysis of ACTN1 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |