Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACTN4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ACTN4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000081-A01 |
| Product name: | ACTN4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ACTN4. |
| Gene id: | 81 |
| Gene name: | ACTN4 |
| Gene alias: | ACTININ-4|DKFZp686K23158|FSGS|FSGS1 |
| Gene description: | actinin, alpha 4 |
| Genbank accession: | NM_004924 |
| Immunogen: | ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK |
| Protein accession: | NP_004915 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |