ACRV1 MaxPab mouse polyclonal antibody (B02) View larger

ACRV1 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACRV1 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ACRV1 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00000056-B02
Product name: ACRV1 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human ACRV1 protein.
Gene id: 56
Gene name: ACRV1
Gene alias: D11S4365|SP-10|SPACA2
Gene description: acrosomal vesicle protein 1
Genbank accession: NM_001612
Immunogen: ACRV1 (NP_001603, 1 a.a. ~ 265 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Protein accession: NP_001603
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000056-B02-13-15-1.jpg
Application image note: Western Blot analysis of ACRV1 expression in transfected 293T cell line (H00000056-T02) by ACRV1 MaxPab polyclonal antibody.

Lane 1: ACRV1 transfected lysate(29.15 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACRV1 MaxPab mouse polyclonal antibody (B02) now

Add to cart