| Brand: | Abnova |
| Reference: | H00000052-M06 |
| Product name: | ACP1 monoclonal antibody (M06), clone 2A3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ACP1. |
| Clone: | 2A3 |
| Isotype: | IgG |
| Gene id: | 52 |
| Gene name: | ACP1 |
| Gene alias: | HAAP|MGC111030|MGC3499 |
| Gene description: | acid phosphatase 1, soluble |
| Genbank accession: | BC007422 |
| Immunogen: | ACP1 (AAH07422, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
| Protein accession: | AAH07422 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |