| Brand: | Abnova |
| Reference: | H00000037-M01 |
| Product name: | ACADVL monoclonal antibody (M01), clone 5D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACADVL. |
| Clone: | 5D3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 37 |
| Gene name: | ACADVL |
| Gene alias: | ACAD6|LCACD|VLCAD |
| Gene description: | acyl-Coenzyme A dehydrogenase, very long chain |
| Genbank accession: | NM_000018 |
| Immunogen: | ACADVL (NP_000009, 345 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI |
| Protein accession: | NP_000009 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ACADVL on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | ACAD9, a complex I assembly factor with a moonlighting function in fatty acid oxidation deficiencies.Nouws J, Te Brinke H, Nijtmans LG, Houten SM Hum Mol Genet. 2013 Nov 6. |