Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACADS polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about ACADS polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000035-A01 |
| Product name: | ACADS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ACADS. |
| Gene id: | 35 |
| Gene name: | ACADS |
| Gene alias: | ACAD3|SCAD |
| Gene description: | acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain |
| Genbank accession: | NM_000017 |
| Immunogen: | ACADS (NP_000008, 132 a.a. ~ 221 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPG |
| Protein accession: | NP_000008 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A novel mouse model of X-linked cardiac hypertrophy.Leatherbury L, Yu Q, Chatterjee B, Walker DL, Yu Z, Tian X, Lo CW. Am J Physiol Heart Circ Physiol. 2008 Jun;294(6):H2701-11. Epub 2008 Apr 18. |