Cart 18 Product Products 5 579,10 € (empty)
No products
To be determined Shipping
5 579,10 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 18 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 579,10 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 579,10 €
Data sheet of ACADM monoclonal antibody (M04), clone 3A2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ACADM monoclonal antibody (M04), clone 3A2
| Brand: | Abnova |
| Reference: | H00000034-M04 |
| Product name: | ACADM monoclonal antibody (M04), clone 3A2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACADM. |
| Clone: | 3A2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 34 |
| Gene name: | ACADM |
| Gene alias: | ACAD1|FLJ18227|FLJ93013|FLJ99884|MCAD|MCADH |
| Gene description: | acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain |
| Genbank accession: | NM_000016 |
| Immunogen: | ACADM (NP_000007, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL |
| Protein accession: | NP_000007 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged ACADM is approximately 10ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |