No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00000032-M01A |
| Product name: | ACACB monoclonal antibody (M01A), clone 1C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACACB. |
| Clone: | 1C11 |
| Isotype: | IgM Kappa |
| Gene id: | 32 |
| Gene name: | ACACB |
| Gene alias: | ACC2|ACCB|HACC275 |
| Gene description: | acetyl-Coenzyme A carboxylase beta |
| Genbank accession: | NM_001093 |
| Immunogen: | ACACB (NP_001084, 22 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT |
| Protein accession: | NP_001084 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |