| Brand: | Abnova |
| Reference: | H00000030-M01 |
| Product name: | ACAA1 monoclonal antibody (M01), clone 3F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACAA1. |
| Clone: | 3F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 30 |
| Gene name: | ACAA1 |
| Gene alias: | ACAA|PTHIO|THIO |
| Gene description: | acetyl-Coenzyme A acyltransferase 1 |
| Genbank accession: | NM_001607 |
| Immunogen: | ACAA1 (NP_001598, 217 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPD |
| Protein accession: | NP_001598 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in human liver. |
| Applications: | WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |